DPCstruct | MC17326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 29.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0056- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JEM9 | 12-165 | ECWWSFLRKHCTQFWMNAFSYLREEGMFTGTYLDKALIQFCFLNLIQTELHDLQLEWNNHRISPSRNRIGPFGRPEIMYTAPELYQT… |
| A0A7M7PTJ0 | 47-211 | MQGTSQHNQRIESWWGVLRKHSIQFWLNMFGQVKDQGHFTGDHLDKSLLQFCFMNLIQEELDKVAKEWNAHRISKSRNQCGPFGRPN… |
| A0A2B4SF62 | 93-275 | None |
| A0A6S7FH10 | 177-355 | None |
| A0A6S7GXC1 | 104-229 | None |
| A0A2H3CCH1 | 241-406 | None |
| A0A2G8LAY9 | 113-310 | None |
| A0A7M5UYJ2 | 1-134 | None |
| M1WGA9 | 2-189 | None |
| A0A146H7I0 | 76-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.