DPCstruct | MC17325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 143 ± 33 aa |
| Standard deviation of domain lengths | 33.33 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4BPS8 | 22-135 | SCIYSQLKLSRDQEAVLQQIKEAYWFICGDGLDSDAVITRCCLTCTSPMESQYFSACSGCGLPAVCHYCGTLENLLDDYEDYKEDLY… |
| A0A2G8JEK7 | 40-159 | SSNAKTVIQCEDCLKCRVCYSSHVLKPPQRRELESELDNLSFSYGSCFQDIDGYEGGIFERVYVNDKLTCASPIEFPYYVTFSDPLC… |
| A0A2N1MQZ3 | 285-478 | None |
| A0A2N0PDB7 | 273-448 | None |
| A0A7S1G023 | 36-174 | None |
| A0A6J8AW07 | 68-224 | None |
| A0A6S7KUL5 | 119-297 | None |
| A0A6P4Z681 | 357-501 | None |
| A0A7M5VAL2 | 295-443 | None |
| A0A2I1EXI5 | 834-969 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.