DPCstruct | MC17322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 249 ± 38 aa |
| Standard deviation of domain lengths | 37.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PFD7 | 125-328 | PTTAGSGGRLTQPGGALNIKGITVTIAGTLRANGEDASYHKDITTGGASGGSIAVTADVLEMSGSVHATGGSGSSYGGGGGGGLVMF… |
| A0A2G8JCC7 | 1-279 | MTVNATVIVLDGVLKATAGAAVTGDNGGGSGGSVYVTTAELDGVGSMESNGGDGHGNGGGGAGGRIAVYTTTTNEYIGSYSSYGGDG… |
| A0A7X7FCT3 | 393-633 | None |
| A0A1F9KSZ7 | 2-168 | None |
| A0A5A8C2G1 | 6-294 | None |
| A0A5A8CSN3 | 138-407 | None |
| A0A5A8CZM3 | 132-369 | None |
| A0A5A8D0N2 | 102-387 | None |
| A0A1D6LZX3 | 222-441 | None |
| A0A5A8DBN8 | 167-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.