DPCstruct | MC17321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644Z1A0 | 386-512 | AENYAVLFKERNMTIKGWSRELVIRTFGEEVADRVFPQFKGRPLSDESEEFAWEFDKLVLNLIEVKGYATEREVTLQLKGSKSITEQ… |
| A0A6N8BLJ5 | 1-135 | MAFAENKALEYKEKGFTMRGWGRELLLRTLGGEEADRVYPQQKGKAITTLNEEVASQMEQITMQLINDKGWTTESEIIENLTLKFKG… |
| A0A150FSW7 | 357-481 | None |
| A0A7C6PXI7 | 1-115 | None |
| A0A1S7FFR2 | 4-133 | None |
| A0A7C6P3S6 | 60-156 | None |
| A0A0M0GAZ7 | 195-333 | None |
| A0A376H7M7 | 497-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.