DPCstruct | MC1732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 262 ± 32 aa |
| Standard deviation of domain lengths | 31.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7DQ80 | 641-900 | SIPHFGTVIPEVVSSWFRLFLYYTLGDGPVSLYIPKGSRVPVIPCALRQCKHLLITTASHEPVIIPADNCLIQLNDILQTHAVFVQE… |
| A0A4Y2KDE6 | 6-281 | KPTKGKNSENESWDHEKLLVTTWAHDPSTVAMSNALPILNDALCHSAVLVQGQGNAAEFCYVPFPLQKGGETGKANQFKEYKWEDHF… |
| G5BAU0 | 405-662 | None |
| A0A287FTV3 | 72-340 | None |
| A0A6G3MFP8 | 1-252 | None |
| B8A2P3 | 1-271 | None |
| A0A813T2E5 | 561-813 | None |
| A0A5A9NQJ8 | 442-764 | None |
| A0A368FJU0 | 1-210 | None |
| A0A0R3S7H4 | 5-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.