DPCstruct | MC17319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5AEK1 | 18-83 | FVTGQLVVEDGKVSLQREDGSMIELSKNDRIEVFRGGKYEPAPYSQIIEKVDSAGWPLYAGLHASA |
| A0A6N8BB06 | 9-83 | IRETAAVADGWQVGTLVIHGNTYHLETDSRLIDITEDHTVEVMNGNNWQAIGQDNLAKKTAEGWPLLAGMKARVK |
| A0A1I4QLT7 | 8-94 | None |
| A0A1X7LXA8 | 1-94 | None |
| A0A3A3GLF6 | 3-88 | None |
| K5A306 | 6-75 | None |
| J2QVM8 | 4-88 | None |
| S9TZ09 | 5-92 | None |
| A0A1I6S1P1 | 4-82 | None |
| A0A7G8X8X0 | 6-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.