DPCstruct | MC17312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496ZAK6 | 2-96 | QIRCPACKKLNDSTDECNRCRGNLSDLRRIRRAAVEELKLGKRYLLRMNSGKALLSASSSWRLKKSVSAAKLAFLASLMGGHFSEAT… |
| S0FTD5 | 2-82 | METCPACKAPFKGRQICHRCKSDLRPLIAVTERAAACLAAARAAFEQNDYQAACGLACQSLALKRSQEAESLYRYAGLLAG |
| A0A7C4MPA6 | 20-106 | None |
| A0A1W9N5T7 | 40-122 | None |
| A0A399H8R6 | 1-85 | None |
| A0A2V8YVF1 | 2-92 | None |
| A0A355UQ85 | 1-93 | None |
| E8R3X4 | 15-105 | None |
| A0A369XQ21 | 3-82 | None |
| A0A847GR78 | 15-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.