DPCstruct | MC1731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2S5E2 | 12-150 | RPEHREKFLPILQHAFYDDLRFCLYAITKEEEEKALETCARELLCLCLEWPLRGLFLETAWKVLKYVEVRYLSVLLYQIFETKRKWK… |
| A0A4Y2KD56 | 1-137 | MPGERRILLPHLGHLCKADDLRFCLYVLTKEEQEKVLESSCIEVLQLHMNWPLARDFLKIAEKTWNFLIEYSFCIVLENLLDRRDRT… |
| A0A4Y2G5H7 | 142-272 | None |
| A0A4Y2LWP2 | 26-179 | None |
| A0A4Y2NS08 | 2-136 | None |
| A0A4Y2NA22 | 275-428 | None |
| A0A4Y2RYG5 | 250-370 | None |
| A0A4Y2RUM8 | 1-125 | None |
| A0A4Y2RPB0 | 85-229 | None |
| A0A4Y2QPF5 | 63-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.