DPCstruct | MC17308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 321 ± 97 aa |
| Standard deviation of domain lengths | 96.66 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0020- CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800BCM5 | 2-178 | AAHTHHAPGSGGSNCYNCHMSYTSVGLMKASRSHAITSPDVAVELATGRPNACNQCHLDRTLQWTVEQLASSWQVERVPLSAEQREV… |
| A0A2E4M990 | 388-722 | MNDPAHYAKEGKSFRPGMNLEEHQELIGENSAPEKVQRYQDMYWNDGTVRIGGRELQGLVMSKCYTVGEATCISCHSMHNYVSADNQ… |
| A0A2E1H5U8 | 184-475 | None |
| A0A2V7SDB9 | 298-580 | None |
| A0A2E1H305 | 1-564 | None |
| A0A2E3ML30 | 22-292 | None |
| A0A523E5Y1 | 384-636 | None |
| A0A7Z9QG74 | 66-424 | None |
| A0A286RM24 | 378-672 | None |
| A0A355F8F9 | 166-785 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.