DPCstruct | MC1730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4PHS2 | 8-98 | KWEKIIVLGVEGGCLTLYGHKNGNAIWQFKILSDETTLMEAGDSRDDYMSESRIVEGCDNAISMLNDKYPYWKRFYLLEIHPDFVAT… |
| A0A1I3L0S8 | 74-182 | RLKVFEVGGEGGSISIFSENKESRTPFYYFEVNDMGFEEEDIPPTCRKSEISYTFWESLMKLRLDKPYLYKLYPHFVAKDYRNDIIS… |
| A0A1H0N4F6 | 2-114 | None |
| A0A1G0IEZ5 | 8-115 | None |
| H3ZDS5 | 1-100 | None |
| A0A371PIN3 | 1-112 | None |
| A0A3L7WPH4 | 1-96 | None |
| A0A2J6JAD6 | 2-111 | None |
| A0A7Y7TGR5 | 2-98 | None |
| A0A3P0X7S5 | 24-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.