DPCstruct | MC173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 201 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06757 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G5BIJ4 | 4-217 | VIALAALISVAYAGVPVARNGPQCQAPNGGGLTPVLKEFFGMIPMEQVGVIFVTAVTSDPEVKKVMAFLESEDFHKILTAIHSQPEF… |
| A0A182RAB8 | 2-171 | HLTNAYYLNDRDFQSMLEYLQSIEFSVVWDGFFSLPMVRDLGLYLTYEGVPFYDYVDLVAYFIGQSPVNNRMVQHPNKTQHRGLKAY… |
| A0A6P7GJW5 | 8-231 | None |
| A0A0L7R8E0 | 9-209 | None |
| A0A195BJE6 | 1-216 | None |
| A0A1A9XV53 | 2-216 | None |
| A0A7R9A3U9 | 5-224 | None |
| A0A2P8YVU1 | 496-667 | None |
| E2BBE1 | 34-250 | None |
| A0A6P6F7A7 | 34-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.