DPCstruct | MC17299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 140 ± 37 aa |
| Standard deviation of domain lengths | 36.71 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 91.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 89.06 |
| Assigned Pfam label(s) | CL0159- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WGC6 | 69-164 | IVPVQLLRLGDVIIIGMPGELTTMAGRRIREAVTARYAEAGETVKVVISGLSNTYSDYITTYEEYQKQRYEGASTVYGPHTHQAYLQ… |
| A0A1G1BY13 | 513-661 | ILSAGVMELLARAETRDGGTVRAAAQSARLPVNPWVCEHRKDDALEWLRHAANTGVFETEVTALRLGDLALVGIPGEIATEIGRGIK… |
| A0A1F9VEL2 | 345-562 | None |
| A0A7C7V592 | 2-142 | None |
| A0A2X3XY87 | 386-528 | None |
| A0A183MMU7 | 720-846 | None |
| A0A5J4Z8W8 | 369-564 | None |
| A0A0C9X142 | 395-492 | None |
| A0A7X7G251 | 38-150 | None |
| A0A3D4HD99 | 100-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.