DPCstruct | MC17297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 21.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1BUQ1 | 180-352 | DHLTLLPSGDPALTRRARKHSQLWAAVLTFNRRLRRQVRIGLLVTAEALAKAEDECAADDEERAERRRRAEVDRTAADQDFIREVTA… |
| A0A6A5RME5 | 7-183 | TVSLSTPMPKGYGFLPKGIRYKTLHCRKLTHNAGRTLYIVINAKKQQLGLRVPNFILHQVHRQAKETFSARRAAVEKRDAASIDAAT… |
| A0A2N3VU38 | 1-170 | None |
| G3JEJ0 | 7-178 | None |
| A0A168BWB4 | 7-181 | None |
| A0A517P0C7 | 126-295 | None |
| C4JIS0 | 29-205 | None |
| A0A2H4SLE1 | 5-176 | None |
| A0A3D8RRY8 | 230-421 | None |
| A0A545V7X6 | 7-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.