DPCstruct | MC17296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 232 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651H5E7 | 103-330 | GGQWGEWMTLALTDPEMREAVVQRTKTELDREYASLFRHLGLDEVELEVLRTILAEEQLTRLERRMLAAGGENGLSWQDATQWAEGR… |
| A0A1G1BRX4 | 117-339 | GHFAKMMEKPEMREAMQAQQKVVLSMLYGNLFKKLNLTPEELDQFKDILVDRQMAGMTMLQAGDKQDRMTAMLEAQQQSESAVKELL… |
| A4SK12 | 47-284 | None |
| A0A2V5MHF3 | 1-233 | None |
| A0A2T6DQA0 | 1-208 | None |
| A0A829Y5L3 | 119-378 | None |
| A0A2A5D6W5 | 80-302 | None |
| A0A2V5PGC5 | 382-598 | None |
| A0A2W4QTU7 | 1-261 | None |
| A0A534F761 | 221-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.