DPCstruct | MC17290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 182 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0HPW6 | 81-262 | DAVAARSTDWAETRPEWGLAGCRAFVAAPRHVTRGKPLGGRAFLHDYDWRQDEGFGVLELILTAPVVVASWISLQYYGSVVAAEVFG… |
| A0A0H4I0N0 | 30-199 | QPKWGLTNNAAMRIGNRALSRGCDLRGRVFIHDYDPEADEDGNVLTIIFGGPVVVASWINLHYFASVTALDTYGAGNKLLHSVIGGN… |
| A0A7U1E947 | 1-183 | None |
| A0A519UGZ0 | 505-677 | None |
| A0A1G7WNQ6 | 322-504 | None |
| M1GPB4 | 1-175 | None |
| A0A7V5MHM7 | 110-299 | None |
| U1Q6R9 | 62-238 | None |
| A0A7C3QX10 | 335-487 | None |
| A0A2T2X529 | 831-1040 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.