DPCstruct | MC1729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 262 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0DW52 | 687-982 | NASTKADCARQQVSPLDVVEKCTDAVPPTVKATLVCARLARNGATVDQLANTCLPNGAGDKAATAACLVSAGTDAERLACVPGIMGP… |
| A0A6P2FF19 | 169-426 | PPVSARPEDAAQCLQVSGSDRQRFVDCMVPKMMTGDQVKAYQCMRRAQDDQLSMTTCLAGTMMGENERRALNQAVDCYKKEGADTTK… |
| A0A4R5QB44 | 191-425 | None |
| A0A1G5UKP7 | 265-536 | None |
| H4FAG9 | 693-988 | None |
| A0A7S7QMS3 | 433-656 | None |
| A0A3E0B8E8 | 177-452 | None |
| A0A1G6ZFQ4 | 383-654 | None |
| A0A442YX10 | 168-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.