DPCstruct | MC17286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5W0F1 | 6-106 | AAPAPAPRAPPIETNANSTNARLSPDAPGTHTIGNYLVFSDCDAAEVQEILVILRNSGFKSYRSFGLPHMDNLSLLKLGLTLGLILG… |
| A0A2N5SZK4 | 137-239 | IGSSSSEMGQVLAQLLSNQNQPTSPSGSDAVASSEDKSDPPAISDYVKFVNIDEDKQASVMKILDKNKVNDYRIFKSKSITVTELKC… |
| A0A180FZK5 | 182-289 | None |
| A0A180GEH5 | 99-214 | None |
| A0A2N5VM58 | 1-113 | None |
| A0A5B0NDQ7 | 50-176 | None |
| E3L3L5 | 97-196 | None |
| A0A0L0W4G2 | 72-172 | None |
| A0A2N5RZ55 | 199-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.