DPCstruct | MC17284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 197 ± 36 aa |
| Standard deviation of domain lengths | 35.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C2T0Y3 | 10-153 | IGLAAIAVHGMPLQKRIAQTISDSTQQWVQACNKAGGGEQCSNVSVTAFSTLLAAAGPCDQQNSADAMIDLAKQLNNDPDMIKLAQI… |
| A0A0L0VN61 | 22-211 | ETPHPPGRLVRRRMSLEHACAAQSKLTTLTDCPGEICQTFAGQAIAPLLAASDECAQQLMADKIIDAAKDLTNSIKSPDTRKQMIAL… |
| A0A0H2ST26 | 1-232 | None |
| W4KLP6 | 245-399 | None |
| A0A4Q9N509 | 295-461 | None |
| A0A0D2PVQ6 | 4-246 | None |
| A0A836AS95 | 14-175 | None |
| A0A397SWW9 | 1-140 | None |
| A0A2S4VEL9 | 93-321 | None |
| A0A180GHW8 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.