DPCstruct | MC17283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 150 ± 22 aa |
| Standard deviation of domain lengths | 22.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0ZZJ2 | 3-141 | DLMLLGIEEQVLELEPDENPGQVFPCMPCEGIHSELRAQLYAQLMGIFFDEAESLEQLTLEFGPYGPYVFKLDFTIVDHLAELAEDD… |
| A0A401V2Z0 | 1-161 | MLATPGVGTVLRQGDGMMWAMGLLTEYFVAPTDEAAASVHSDSIPAHAVDGGGIEPVVHLGTLEELLTGRTFEEVLDDAPTSPVADR… |
| A0A5D0U4G4 | 64-260 | None |
| A0A286PGT0 | 1-134 | None |
| A0A2S0QYW6 | 1-131 | None |
| A0A2U1EG68 | 2-133 | None |
| A0A8A5UHT8 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.