DPCstruct | MC17281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5CRW2 | 492-643 | ANGAKFSDEQNPIPLLQVGQPGDVGSVEISDLTLLTKGPAPGAILMEWNIAEESLGSVGMWDVHFRVGGSAGTELQSDRCAKNPNVT… |
| C5FV47 | 4-155 | ATGKAFSDMKNPIPMLQVGQPGDKGTVEMSDIIVTTKGPAPGCILVEWNVAEQTQGSVGMWDVHFRVGGFAGTELQSNTCAKTPNSK… |
| A0A6G1MHQ6 | 1-113 | None |
| A0A2S4L0D2 | 679-833 | None |
| A0A2V1CVT0 | 84-243 | None |
| J3PE45 | 436-584 | None |
| U7Q190 | 654-813 | None |
| A0A2P6MN78 | 709-862 | None |
| A0A2P6MUI7 | 846-997 | None |
| A0A4Y9YIN8 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.