DPCstruct | MC1728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2TQ77 | 1-84 | MKALTGNRLTDGEVVFWKAGAWVERFADADLFDDAAAAEAAEADAKAQRTVVVDPYLIDLVESSGLWAPLSFRERVRALGPTNH |
| A0A1H9LWZ4 | 1-89 | MDIITANRLSDGAVVFLTASGWSTRIAEAQALEGKESVAAALARAAADAEASIIVEPYPVDVERRAQGLTPTKLRERIRAQGPTVGH… |
| A0A7C7XXW6 | 2-101 | None |
| A0A6A5L9P1 | 653-744 | None |
| A0A2G1YVI5 | 13-109 | None |
| A0A318MW74 | 37-126 | None |
| A0A661E8Y9 | 1-76 | None |
| A0A840XF21 | 2-98 | None |
| A0A832IZ23 | 29-99 | None |
| A0A1W9Q883 | 36-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.