DPCstruct | MC17279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 181 ± 31 aa |
| Standard deviation of domain lengths | 30.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 62.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.23 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5M5A9 | 1-120 | MRPWIFAFTALAISVLAQDPGPSPTESVGCEPHGDHWHCDGPASSTAVAISTHSHGDNDDEATITPTAPSPMASVGCEPHGDHWHCD… |
| C5FBT9 | 2-186 | ATPTKPSPTESVGCEPHGDHWHCDGPRVTSVAPDSPSDTATMSLKPSPTESVGCEPHGDHWHCDGPRITSTEAPSQTTGTTTKSLKP… |
| A0A0N0V817 | 8-200 | None |
| A0A0P7AU48 | 85-284 | None |
| A0A0A2KJL7 | 1-200 | None |
| A0A0U4ZNV4 | 1-212 | None |
| A0A094K0T8 | 1-185 | None |
| A0A428SK15 | 24-240 | None |
| A0A447C1E5 | 11-188 | None |
| A0A084G3N0 | 116-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.