DPCstruct | MC17278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 277 ± 51 aa |
| Standard deviation of domain lengths | 51.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7VFX5 | 5-283 | RKQLGGLLLFLISFSGFTSCKEYLDAKPDQHLQIPSTLQDLQSLLDNRVYVADYDVTNLNAFSDDYFCTYENWQTFPTSDQNVYIWS… |
| A0A7Y3AW38 | 2-310 | GTMARELYLFDADPRNTGDLLGKDGIGLDNNSFYSTQQWNGSYRATKNANLLIEAASNTEFVTDAESNGYIGFAKTMQAYELIQVLK… |
| A0A015SRV6 | 5-220 | None |
| A0A7K3KIC3 | 3-302 | None |
| A0A7K0I608 | 6-346 | None |
| A0A3R8P6G6 | 2-222 | None |
| A0A418R683 | 6-293 | None |
| A0A1G6G5H2 | 39-331 | None |
| I8YG77 | 9-313 | None |
| A0A521GF14 | 44-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.