DPCstruct | MC17274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 411 |
|---|---|
| Mean domain length (aa) | 340 ± 68 aa |
| Standard deviation of domain lengths | 67.85 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 11.82 |
| Pfam Score | 89.65 |
| Assigned Pfam label(s) | CL0052- PF00305- CL0649- CL0059- CL0176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226DCN9 | 4-298 | RMFKLQSIFSLLYTIATFLCVCFGRLTLTEKFQGSVFLILDILLTATRWNYSLDPSPGQIVNVFINFEKEILKGHPNPPTSLGTELM… |
| D6WWX4 | 22-376 | WPGEKYQLNVYSFYAFTVIILILCGQTLSTGLTLILGSGDVDTFTETLFVVNIEFMTAWKALNFALNRKKFIQLLNAIDKPMFQPRN… |
| A0A7S1F2F1 | 75-460 | None |
| A0A2P8ZPB2 | 12-290 | None |
| A2AX97 | 4-249 | None |
| A2AXC1 | 7-389 | None |
| A2AX87 | 2-207 | None |
| A0A139WFL5 | 10-359 | None |
| A0A139WCR5 | 867-1263 | None |
| A0A835ACX1 | 162-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.