DPCstruct | MC17270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 150 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0604- PF06916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0EFD7 | 38-209 | RLLSTSPKNLKFSFSMDEDTKNKKLKGIIKEKIESPPTTAAGKLKYYIKRYGYIAIPVYILVYGSFLFGFYCLVKSGVDIVNIMEQL… |
| D6WNA6 | 27-205 | SRCTATVIINFNHNYGTPNPRNHKLLQPFKTTEIQHFYSDLSKNKKKPSIFQRFKQMYKEYWYVLLPVHLVTSAAWFGGFYYLAKSG… |
| A0A7M7N4U1 | 179-299 | None |
| A0A7S4A8E2 | 1-113 | None |
| A0A1D1W8T3 | 137-303 | None |
| A0A3S3RL90 | 178-299 | None |
| E9IJW4 | 451-592 | None |
| A0A0B1SE88 | 2-136 | None |
| T1KXN5 | 56-233 | None |
| A0A2S2QYL8 | 32-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.