DPCstruct | MC1727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0Z9Y0 | 42-170 | ERLAEWLLTIWLLNWGVTLAYGGTFEAPAFAVLKSWASIETWSLFCLIGGGGRLMLLILNGGWRKSPHFRVLAALGTVPFWVAVAYG… |
| A0A1H9I7L3 | 21-152 | KVRVAEWALGTILFNFGWILLLPAQTFDGPSYAGMARVAPEGVWGLACLIVGAARLVALFINGTRRRTPHVRAIMAFLSCFFWLQIS… |
| A0A2E2P4S5 | 10-169 | None |
| A0A1W2EK97 | 11-132 | None |
| A0A0C6G133 | 19-158 | None |
| A0A0Q5E386 | 1-129 | None |
| A0A179S396 | 2-120 | None |
| A0A2E8A959 | 19-156 | None |
| A0A389MLF1 | 14-142 | None |
| A0A2G8RGI5 | 10-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.