DPCstruct | MC17266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5EKZ4 | 14-110 | SKPFRSYMICTAPRSGSTLLCGLLAATSLAGNPDSHFHSSSLGDWLDDYGLKQTDYASREECLRAVFTCAVERGKGDTDIFGLRMQP… |
| A0A800BGQ5 | 3-109 | NYLICATQRCGSTLLTELLARTGVAGAPNEYLLLWEQHAAKNDADFWRLAVQHTLKLGRTDNGEWGAKVMANYFPGCMKQLRCAPEV… |
| A0A7D5MVC0 | 22-124 | None |
| A0A4Q6DBJ9 | 31-145 | None |
| A0A525KBP0 | 41-192 | None |
| X8FFN9 | 3-118 | None |
| A0A6J7M2C2 | 16-120 | None |
| A0A1Y6D5V9 | 123-229 | None |
| A0A2V5VQX8 | 1-116 | None |
| A0A359EBB8 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.