DPCstruct | MC17265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 196 ± 44 aa |
| Standard deviation of domain lengths | 43.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8HIC8 | 36-206 | SLFTTSDNCIACHNMLVTPQGEDVSIGASWRSTMMANSGRDPYWQAGVRRETIDHPTHAAAIQDECAECHMPMATQISRASGGKGEV… |
| A0A800BDG3 | 23-207 | NFMPTVVAPTDVQFPGTQPGQAALLAGVSNCSSCHGYYDQATEPLENWMGSMMSQAGRDPVFWAALAVAEGDYPGAGDFCIRCHSPR… |
| A0A6N2TEJ5 | 25-235 | None |
| A0A1F8PDN1 | 46-246 | None |
| A0A7C7Z8N6 | 133-304 | None |
| A0A3M1D854 | 57-239 | None |
| A0A2D5ASX3 | 220-407 | None |
| A0A2E0R413 | 141-342 | None |
| A0A7Y3U959 | 6-197 | None |
| A0A523L250 | 28-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.