DPCstruct | MC17264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 39 ± 3 aa |
| Standard deviation of domain lengths | 2.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 80.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LNI8 | 56-92 | MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGVSN |
| A0A452Z9J6 | 1-44 | MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGVNQRRVFRRS |
| A0A0E0PNJ4 | 131-168 | None |
| A0A453FWE6 | 1-34 | None |
| A0A453FWD9 | 16-56 | None |
| A0A2U1LQL5 | 1-38 | None |
| A0A0A9N435 | 1-42 | None |
| A0A5C7I5U1 | 1-38 | None |
| A0A830BIV3 | 1-38 | None |
| F6I624 | 216-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.