DPCstruct | MC17263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 75.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9AZU2 | 135-196 | KKPTPKLNERILSSLSRRSVAAHPWHDLEIGPGAPEIINVVIEIPKGSKVKYELDKKTGLIK |
| A0A834HAT1 | 1-76 | MSEETNANETPEQTQRRVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNCVVEITKGSKVKYELDKKTGLIK |
| A0A7J6GSJ8 | 1-77 | None |
| A0A5D2SCN6 | 1-77 | None |
| K7K9V4 | 22-92 | None |
| I3SBA6 | 1-78 | None |
| M7ZHU8 | 36-116 | None |
| A0A0D2Q5Q7 | 1-77 | None |
| A0A445LRQ1 | 85-157 | None |
| A0A078JVC1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.