DPCstruct | MC17262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.26 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0023- PF02704 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803QVS7 | 9-69 | EFCDSKCKVRCSKAGVQDRCLKYCNICCEKCHCVPSGTYGNKDECPCYRDLKNSKGHPKCP |
| A0A452Z6S8 | 41-121 | ALVVLLLLVETTAPSGQAHAVDCGSACSYRCSKSSRPNLCNRACNTCCRRCDCVPPGTAGNEDVCPCYAHMTTHDGRHKCP |
| F6HCR9 | 14-84 | None |
| A0A4Y7JGD1 | 79-159 | None |
| A0A1Z5S650 | 102-199 | None |
| A0A6A3AYK2 | 1-103 | None |
| A0A7C9DDA9 | 32-121 | None |
| A0A059AQX8 | 206-287 | None |
| A0A835ADK3 | 37-111 | None |
| A0A5D2A5K5 | 39-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.