DPCstruct | MC17261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 167 ± 29 aa |
| Standard deviation of domain lengths | 29.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452Z5H9 | 2-168 | CEDFRLFVQKEHSKRLTVAELEEKARSVHRDIVTHWIDKELKRLDNLIELANEKGWRCEKLEYIDKRQLLRSPSERQRLLEEVPRVI… |
| A0A0V0H9N8 | 19-126 | ECNVFREKVKAGLLKKLTIMELEQKAEILHEDITKHNIAQELQLLQNRIDRANEKGWRDQLTQSLEKRHILQQPWYLSFKLLTNPVV… |
| A0A4V3WMR0 | 91-308 | None |
| A0A446K240 | 130-286 | None |
| A0A3Q7ERB7 | 94-271 | None |
| A0A3N7F0R8 | 225-397 | None |
| A0A7C8YWT4 | 31-167 | None |
| A0A0B0NBM4 | 1-123 | None |
| A0A0V0IG78 | 12-187 | None |
| B4FKI0 | 51-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.