DPCstruct | MC17259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0727 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6REQ6 | 627-713 | GEVLGAVYLVEGLNIKPSLQAKSISIVSNSTISTDGQIVINKESANSVKVLGDFSSEEYYKRVANSLGNMKQTAVITSFEEQTIIWS |
| A0A452Z364 | 4-76 | SLLLKPISIIADNTTSTDGQVVVNEQSANLVKVLEDFDSDEYYSRVANHLGNMERSAVIGSFTEQRASWSRQP |
| A0A4U6VDH6 | 600-694 | None |
| A0A2U1N854 | 64-167 | None |
| A0A4U6VIU1 | 271-360 | None |
| A0A6A1VRA4 | 775-873 | None |
| A0A2N9HJ47 | 12-102 | None |
| M0ZZP5 | 110-194 | None |
| A0A2Z6M887 | 2-96 | None |
| A0A833VQ76 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.