DPCstruct | MC17258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 133 ± 3 aa |
| Standard deviation of domain lengths | 3.01 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.24 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0179- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446J2N2 | 1-132 | MDIPHALFEEKLEAMKATKGVDNDTDLTANDLRELVGQYKNVYVEAKGEQFPSDPKRQLQLAVLAVFDSWDSPRANKYRSINQITGL… |
| A0A452Z2X0 | 95-225 | MDIPHALFEEKLEAMKAAKGVDNDTDLTANDLRELVGQYKNVYVEAKGEQFPSDPKRQLQLAVLAVFDSWDSPRANKYRSINQITGL… |
| A0A1Z1WQJ5 | 141-275 | None |
| A0A380FM77 | 43-178 | None |
| H2K6P8 | 1-132 | None |
| A0A7C4NU46 | 678-808 | None |
| A0A2P9IQ49 | 141-273 | None |
| W7TQY3 | 254-383 | None |
| A0A2U1QDL6 | 273-408 | None |
| W7C1N9 | 147-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.