DPCstruct | MC17256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 235 ± 47 aa |
| Standard deviation of domain lengths | 46.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1EVQ7 | 72-312 | YIILYPDILAKGWGWQRLVPYSPNSVQWPDFKRYLENYFTENRGKVAALCAQHKPEPVGQGVAYEYNELCAAANMCIGMESKLLRTS… |
| A0A452Z1E5 | 1-233 | MEHTWGWDRLIPWAPDYVLFKVYLDYLTDYFHQNFPANINLYAAACSCLEMEKKLSCLVGFTADLNELSNNIKEKAGSVTKTGPECP… |
| A0A1Z5S593 | 41-374 | None |
| K4ALQ9 | 5-137 | None |
| A0A368Q9N9 | 252-491 | None |
| A0A3B6AUU0 | 19-302 | None |
| K3YL93 | 2-158 | None |
| A0A804LBS1 | 206-449 | None |
| A0A804LBS3 | 16-320 | None |
| A0A834ZZC2 | 40-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.