DPCstruct | MC17255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 158 ± 38 aa |
| Standard deviation of domain lengths | 37.52 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8C4U0 | 3-124 | PIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCAFDAYVEDAFKSDEDIHPQFRRKFRVIRADSYLKNFASDRSHM… |
| A0A452Z0J9 | 1-154 | MIIQLQCEENVHLLCKELIRAGLADPAGNDLYAVFVSNEEKKIPLWYQKASRTNDGFVLWDYHVICIQSRRNKGDVLDLVWDLDSSL… |
| A0A7S1QWZ5 | 40-243 | None |
| T1ESK0 | 174-263 | None |
| A0A109FMB3 | 1-151 | None |
| A0A2G2XAD6 | 349-520 | None |
| A0A284QUW2 | 9-141 | None |
| A0A146H6K5 | 283-441 | None |
| A0A2G3CDQ6 | 269-438 | None |
| A0A7R9PWG4 | 140-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.