DPCstruct | MC17253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 100 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6QPG7 | 3-65 | LNKQIVEFCEEAGIGMKQYLAPYTTQQQWKAHFGARWETFERRKHRYDPLAILAPGQRIFPKA |
| A0A452YZB9 | 9-109 | WDNRTSVVIPNEEVFYLVGFLHSAIGPHSIKRTLNLNNQIIEFSNKASIGVRQYLPNYTTEPEWKAHYGARWDAFQQRKNTYDPLAI… |
| A0A287KCD7 | 171-266 | None |
| D7MW01 | 165-258 | None |
| A0A6A5PKU3 | 800-928 | None |
| A0A453EDP0 | 2-73 | None |
| A0A6A3CVC5 | 264-421 | None |
| A0A2Z6NG95 | 56-159 | None |
| A0A438FWG8 | 270-374 | None |
| M1D3T7 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.