DPCstruct | MC1725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 191 ± 47 aa |
| Standard deviation of domain lengths | 46.52 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 64.10 |
| Assigned Pfam label(s) | PF08399- CL0165- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9LYA1 | 22-189 | MEDLLDEKKKAVMRLKAAAQNSMKNYGAYTNTIDFNDVKYYNAKKVVIETDLENMDNDTKDAIKETINYLPTEPMWSFKKEEMRPKL… |
| A0A6G1Q2V3 | 11-203 | VRVEEIDGLRLVKRLAEDMEEMFHKKAQAMKRLVEAAEEAHLQHEEDPNLQYEYFNAVLINEVDEEGNSVELGGEFILQPNDHFNNL… |
| A0A6A4VHY1 | 36-176 | None |
| A0A1X6PH68 | 14-256 | None |
| A0A668AFN1 | 78-275 | None |
| A0A183WNT4 | 8-141 | None |
| A0A6V7H9I7 | 2-283 | None |
| A0A7D9LBN2 | 36-200 | None |
| A0A7X7DGK8 | 529-712 | None |
| A0A7S3LUJ6 | 57-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.