DPCstruct | MC17249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 62.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9WE90 | 129-182 | MTNEMREAVRDVARYFPTAIVTGRCRDKIYSFVKLAGLYYAGSHGMDIKGPSKR |
| A0A453B1H7 | 109-164 | MREAVRGVAQHFPTAIVSGRCRDKVFNFVKLEELYYAGSHGMDIKGPTKVSNHKAK |
| A0A427A7J5 | 137-190 | None |
| A0A078HQ02 | 102-161 | None |
| A0A287HIZ5 | 176-231 | None |
| A0A836DJJ6 | 1-47 | None |
| A0A453E1E8 | 1-63 | None |
| A0A103XJM7 | 136-207 | None |
| A0A5D2WSP7 | 143-195 | None |
| A0A6N2KAM7 | 99-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.