DPCstruct | MC17247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 175 ± 20 aa |
| Standard deviation of domain lengths | 20.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YRP6 | 1-172 | MVETFYKNLPLSRDLDPQESMHGEELLSMASNILVQLFWRTRNLGYLLEAVLVLEFGLTVRKHVWQYKITLVHLYSYLGALPLAHRW… |
| A0A0T6AZE1 | 189-380 | EHLNALVTALSLHYQHGYQTYGQNLLPTDQGPSDPYALLAAHVLYDLAQQTQSSEHIVLALVLLDNLLNNSPSNFHAKLLSVKLYHT… |
| A0A7S0DK31 | 2-182 | None |
| E2LFU9 | 34-191 | None |
| A0A7J7Q7Y3 | 345-528 | None |
| A0A1Y2H8Y8 | 166-326 | None |
| A0A7S0M486 | 1-200 | None |
| A0A7S2IWL4 | 11-145 | None |
| A0A452YRU1 | 82-247 | None |
| A0A452YRQ9 | 211-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.