DPCstruct | MC17246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 139 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 83.25 |
| Assigned Pfam label(s) | CL0123- CL0040- CL0125- CL0383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376P644 | 20-180 | TGRARRHGLHTDASHRYERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHYIADEQVTDIL… |
| A0A452YQX1 | 3-134 | MFSEYCENKFEVEPVEVVSHDGSTAIYPDLSCYKMEVSLSDIVGPIGISLDETQVISLLNKMQLQADLCSSNREPCISVSVPPTRSD… |
| K2D7H2 | 519-652 | None |
| A0A2R6CSQ8 | 711-845 | None |
| A0A837Q1U2 | 25-160 | None |
| A0A401FKK8 | 135-291 | None |
| A0A7Y3PI76 | 1-110 | None |
| A0A7V6GNP8 | 391-493 | None |
| A0A3Q0JHG0 | 69-212 | None |
| A0A831V2C2 | 236-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.