DPCstruct | MC17245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 21 aa |
| Standard deviation of domain lengths | 20.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YL98 | 2-125 | RRVRPVREAMSSIGSSNIGFQLLKKSGWKEGTGLGAQEQGRLEPVETRVKNNKRGLGSKEPKPKPKVEDDVETAPSRRPKQDAPVTK… |
| A0A0L0HEN3 | 144-240 | PGRSAPNYGLDATNKGFQMLQDQGWTYGTGLGVDEQGRQQPIATRLKRDRRGVGGETGRKRVTHTLVEAHVERVTKKRRKELVEKER… |
| A0A0D6DQF0 | 87-206 | None |
| Q9FT47 | 64-168 | None |
| A0A061S7Z1 | 3-133 | None |
| A0A397Y3L1 | 2-109 | None |
| A0A7J7GG33 | 24-107 | None |
| A0A0B1S6E8 | 28-130 | None |
| W9RLL6 | 21-151 | None |
| A0A2T9YYE7 | 11-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.