DPCstruct | MC17240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 294 ± 29 aa |
| Standard deviation of domain lengths | 28.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 65.28 |
| Assigned Pfam label(s) | CL0228- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YDB8 | 1-333 | MVFLLFSAATSFAKTPLQPILPLLEAMPSDLHVTVPYLLSFVMADPLKMAMVSIENNLSPPETLQKLSESLTSLLPLLSQLADIIPR… |
| A0A452YD93 | 2-245 | LADIIPRDALLWKLKLLKSGAAYANSRLHAVQAEVLFLASGKDNLLPSGEEADRLFKGLKNCRVRYFKENGHTLLLEDGVNLLSVIK… |
| A0A7J0ELN8 | 168-458 | None |
| A0A287RVM4 | 137-412 | None |
| A0A446UFH4 | 50-364 | None |
| A0A2U1NUR2 | 221-548 | None |
| A0A446JSY5 | 1-295 | None |
| A0A2K1INI3 | 242-548 | None |
| A0A0A9D675 | 1-298 | None |
| A0A6S7NVM1 | 6-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.