DPCstruct | MC1724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803XVR2 | 10-71 | GHALQQCHPTVCAGTLNGLSVTGDAQHQYRTLHKMYNNCEIVMGNLEIVLIDHTQDLSFLQV |
| A0A6G1PXW5 | 19-78 | FGSSSSQSVCAGTENKLSTLSDLEQQYRTLRKYYENCEVVMGNLEITSIDRNRDLTFLRV |
| A0A1S3QNK0 | 16-74 | None |
| A0A834CKZ6 | 3-86 | None |
| S9WSN6 | 2-54 | None |
| A0A3M0INZ7 | 23-80 | None |
| A0A3Q4MZ03 | 3-64 | None |
| A0A835NDF0 | 57-127 | None |
| A0A7F8QU18 | 5-76 | None |
| A0A4W5KMV5 | 10-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.