DPCstruct | MC17237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 363 ± 69 aa |
| Standard deviation of domain lengths | 68.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YBW3 | 4-300 | HLLRVCLEYQRTCAASLGSNSYNAYKDPNPPVLFKMVEPLTALQEKVRTFLDEWPDHPGLLKILEIIASLLAMPLSAPLSKVLLGLQ… |
| B8P5M1 | 5-306 | YNFYLDANLLETRKALQTLSTLGQRLNSLLEEWPDQMVLQHLRFRCTMILSFDLSSPVAKILSAVEHLLLQIEDWEMYANRTNSLRS… |
| A0A1X7TK49 | 20-430 | None |
| A0A094FVG7 | 334-795 | None |
| A0A3S3MTS9 | 578-872 | None |
| A0A2H2JLF7 | 228-611 | None |
| K5VYC4 | 442-957 | None |
| A0A0R3QWS6 | 125-494 | None |
| A0A2C6AIA0 | 1-338 | None |
| A0A095B4M4 | 357-719 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.