DPCstruct | MC17234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2X9X7 | 1-169 | AELNHKLDALSNFHFTPKPYVEELKVTTSAPAVAMEEVIPMAVSSEQQTAPQEEFRSKEKGMPTERGEMSQKERQTKRLTKKRKQRK… |
| A0A074Z982 | 56-180 | VKNSIQAEMRELFEKLDSLSHLHFVPYKHSPEATVLQSKQAMVMEEAGPAATSTADLLAPEEVFAPRGEVLKGATELTSTDRRRHRK… |
| A0A446U355 | 242-343 | None |
| A0A074S9D3 | 595-753 | None |
| A0A7S2RIS6 | 6-190 | None |
| A0A167QRR4 | 2-141 | None |
| A0A1E3IAQ5 | 609-754 | None |
| B8BLX8 | 437-586 | None |
| A0A2P8XH15 | 30-216 | None |
| A0A4U0W2F5 | 738-889 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.