DPCstruct | MC17232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8AW85 | 2-53 | LEKLVDHYGWNELGDLIRINSFNSNPGFKSSLKFLRKTDWARKKVEDLYVET |
| A0A2D5VM77 | 23-95 | QGAQKDPLHGVSLETIVRELEQRFGWDGLAQRIDINCFKKDPSVKSSLKFLRKTPWARSKVEALYVRTCSAQK |
| A0A1Y5GMB5 | 4-72 | None |
| A0A7R9URR4 | 1-91 | None |
| A0A1Q6CL84 | 5-70 | None |
| Q7UL87 | 79-151 | None |
| L1JSN5 | 371-447 | None |
| A0A7U4E8B8 | 69-138 | None |
| A0A2G6T024 | 40-111 | None |
| A0A2K8XCQ4 | 16-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.