DPCstruct | MC17229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 151 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 45.74 |
| Pfam Score | 87.87 |
| Assigned Pfam label(s) | PF15628- PF15629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8A274 | 306-483 | HQVYELPDSHPLLEGFEQREPDDPCPYLLSIWTPGETAQSIDAPKTFCDSGETGRLCGSSICFSCNNIREMQAQKVRGTLLIPCRTA… |
| A0A7C9D871 | 17-170 | LDRRDEKDPLPYLLAVWTPDQIKRVAESMEESNKHSVSLDDDVQDESLTVPGTLLIPSRTAMRGFFPLNGTYFQVNEVFADDESSQR… |
| A0A6A6N8M1 | 149-260 | None |
| A0A4V6A435 | 418-560 | None |
| A0A151TV26 | 875-1011 | None |
| A0A453DRM7 | 4-145 | None |
| A0A2G2WUX1 | 476-626 | None |
| A0A6L2NFB9 | 121-284 | None |
| A0A835U6Y5 | 482-642 | None |
| A0A1D6QN83 | 1709-1895 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.