DPCstruct | MC17228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 196 ± 33 aa |
| Standard deviation of domain lengths | 33.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9D6W6 | 45-251 | RKREKRRKREKEDEKRKKKRRREKEEKRKKKRRDKEKGKVGAVTNSWGKYGIIREIDMWNKRPEFTAWLAEIKQVNLESLPNWEEKK… |
| A0A7S0VT94 | 18-178 | KDKGEDSKNLNDQFGKYGFIRPSEKYQKQDEFRAWLSEVKQIDWGMLQGRDRDELWAEFVEDFNTATLPHVKYYNIYEWEQNDAQKK… |
| A0A0G4HXJ1 | 45-281 | None |
| A0A2H3CAZ2 | 18-222 | None |
| A0A1V9Z389 | 281-505 | None |
| A0A5B8MEQ0 | 91-278 | None |
| M4CFQ2 | 21-216 | None |
| K5W3T0 | 2-123 | None |
| C1MNH9 | 228-397 | None |
| A0A0P1AHD7 | 120-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.