DPCstruct | MC17227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1VPI3 | 1-120 | MAERSKVHVPLPHAVEQLLQKICREQNQTLPTADVLQELASRGEEKALELLRHISSSKIKKSLGGFIHYMLRTAPYNSPQRMAGISP… |
| A0A072UMV2 | 1-123 | MAEQPIIFSVSIENLIDKICKEQTQQPLDHLARRRLAAIEEQQAFTLLTNISKCKITKSLNAYVMHMLKQPPYSHSPSNPSPSSSST… |
| A0A4S4E1N0 | 1-103 | None |
| A0A2P6RJU2 | 1-128 | None |
| A0A2P5B8M5 | 4-108 | None |
| A0A2G2X3T9 | 21-159 | None |
| A0A2Z6N0Z1 | 1-120 | None |
| A0A6J5VM25 | 43-162 | None |
| A0A835D824 | 1-117 | None |
| A0A5E4E6R3 | 49-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.